Wir durchsuchen für Sie über 5 Millionen Angebote von über 150.000 Anbietern.
Wir durchsuchen für Sie über 150.000 Anbieter.
Filtern nach:
Anbieter-Standort
Alle Länder anzeigen Weniger Länder anzeigen
Preis
Marktplatz
Zeige alle Marktplätze Zeige weniger Marktplätze Auswahl aufheben
Qualität / Grad
Maßeinheit
Incoterms
Ansicht nach:
Preise anzeigen in
Sortieren nach:
Filter
Filter
USD
alert-icon
Jemand hat gerade das gleiche Produkt gesucht!
alert-icon
Jemand hat gerade das gleiche Produkt gesucht!
Filtern nach:
Anbieter-Standort
Alle Länder anzeigen Weniger Länder anzeigen
Preis
Marktplatz
Zeige alle Marktplätze Zeige weniger Marktplätze Auswahl aufheben
Qualität / Grad
Maßeinheit
Incoterms
Preise anzeigen in
Wir durchsuchen für Sie über 5 Millionen Angebote von über 150.000 Anbietern.
Wir durchsuchen für Sie über 150.000 Anbieter.
Peptide www.diytrade.com
Preis auf Anfrage
Peptide www.diytrade.com
Preis auf Anfrage
Psyclo Peptide.,Inc.
China
RGDS peptide www.molbase.com
23,22 $ pro Milligramm
RGDS peptide www.molbase.com CAS-Nr.: 91037-65-9
23,22 $ pro Milligramm

HA PEPTIDE www.molbase.com
77,18 $ pro Milligramm
HA PEPTIDE www.molbase.com CAS-Nr.: 92000-76-5
77,18 $ pro Milligramm

MCD peptide www.molbase.com
383,00 $ pro Milligramm
MCD peptide www.molbase.com CAS-Nr.: 32908-73-9
383,00 $ pro Milligramm

333,00 $ pro Milligramm
Proinsulin connecting peptide www.molbase.com CAS-Nr.: 11097-48-6
333,00 $ pro Milligramm

340,08 $ pro Milligramm
GASTRIN RELEASING PEPTIDE, PORCINE www.molbase.com CAS-Nr.: 74815-57-9
340,08 $ pro Milligramm

166,00 $ pro Milligramm
Brain Natriuretic Peptide-32 rat www.molbase.com CAS-Nr.: 133448-20-1
166,00 $ pro Milligramm

399,83 $ pro Milligramm
Amyloid?|A-Peptide (1-42) (human) www.molbase.com CAS-Nr.: 107761-42-2
399,83 $ pro Milligramm
RGDS peptide www.molbase.com
26,54 $ pro Milligramm
RGDS peptide www.molbase.com CAS-Nr.: 91037-65-9
26,54 $ pro Milligramm
HA PEPTIDE www.molbase.com
91,50 $ pro Milligramm
HA PEPTIDE www.molbase.com CAS-Nr.: 92000-76-5
91,50 $ pro Milligramm

RGDS peptide www.molbase.com
33,16 $ pro Milligramm
RGDS peptide www.molbase.com CAS-Nr.: 91037-65-9
33,16 $ pro Milligramm
HA PEPTIDE www.molbase.com
86,15 $ pro Milligramm
HA PEPTIDE www.molbase.com CAS-Nr.: 92000-76-5
86,15 $ pro Milligramm

RGDS peptide www.molbase.com
30,00 $ pro Milligramm
RGDS peptide www.molbase.com CAS-Nr.: 91037-65-9
30,00 $ pro Milligramm

430,77 $ pro Milligramm
Proinsulin connecting peptide www.molbase.com CAS-Nr.: 11097-48-6
430,77 $ pro Milligramm

323,08 $ pro Milligramm
Brain Natriuretic Peptide-32 rat www.molbase.com CAS-Nr.: 133448-20-1
323,08 $ pro Milligramm

0,62 $
Amyloid?|A-Peptide (1-42) (human) www.molbase.com CAS-Nr.: 107761-42-2
0,62 $
RGDS peptide www.molbase.com
31,50 $ pro Milligramm
RGDS peptide www.molbase.com CAS-Nr.: 91037-65-9
31,50 $ pro Milligramm

HA PEPTIDE www.molbase.com
51,87 $ pro Milligramm
HA PEPTIDE www.molbase.com CAS-Nr.: 92000-76-5
51,87 $ pro Milligramm

MCD peptide www.molbase.com
0,43 $
MCD peptide www.molbase.com CAS-Nr.: 32908-73-9
0,43 $

316,33 $ pro Milligramm
Proinsulin connecting peptide www.molbase.com CAS-Nr.: 11097-48-6
316,33 $ pro Milligramm
HA PEPTIDE www.molbase.com
16,48 $ pro Milligramm
HA PEPTIDE www.molbase.com CAS-Nr.: 92000-76-5
16,48 $ pro Milligramm

RGDS peptide www.molbase.com
10,22 $ pro Milligramm
RGDS peptide www.molbase.com CAS-Nr.: 91037-65-9
10,22 $ pro Milligramm

SAMS Peptide www.molbase.com
17,00 $ pro Milligramm
SAMS Peptide www.molbase.com CAS-Nr.: 125911-68-4
17,00 $ pro Milligramm

FLAG tag Peptide www.molbase.com
12,60 $ pro Milligramm
FLAG tag Peptide www.molbase.com CAS-Nr.: 98849-88-8
12,60 $ pro Milligramm

MLCK inhibitor peptide www.molbase.com
19,20 $ pro Milligramm
MLCK inhibitor peptide www.molbase.com CAS-Nr.: 198694-74-5
19,20 $ pro Milligramm

Dynamin inhibitory peptide www.molbase.com
72,00 $ pro Milligramm
Dynamin inhibitory peptide www.molbase.com CAS-Nr.: 251634-21-6
72,00 $ pro Milligramm

434,00 $ pro Milligramm
G-Protein antagonist peptide www.molbase.com CAS-Nr.: 143675-79-0
434,00 $ pro Milligramm

ANTI-INFLAMMATORY PEPTIDE 1 www.molbase.com
5,60 $ pro Milligramm
ANTI-INFLAMMATORY PEPTIDE 1 www.molbase.com CAS-Nr.: 118850-71-8
5,60 $ pro Milligramm

14,40 $ pro Milligramm
Urotensin II-related peptide www.molbase.com CAS-Nr.: 342878-90-4
14,40 $ pro Milligramm

Akt/SKG Substrate Peptide www.molbase.com
15,90 $ pro Milligramm
Akt/SKG Substrate Peptide www.molbase.com CAS-Nr.: 276680-69-4
15,90 $ pro Milligramm
HA PEPTIDE www.molbase.com
77,18 $ pro Milligramm
HA PEPTIDE www.molbase.com CAS-Nr.: 92000-76-5
77,18 $ pro Milligramm

RGDS peptide www.molbase.com
19,77 $ pro Milligramm
RGDS peptide www.molbase.com CAS-Nr.: 91037-65-9
19,77 $ pro Milligramm

340,08 $ pro Milligramm
GASTRIN RELEASING PEPTIDE, PORCINE www.molbase.com CAS-Nr.: 74815-57-9
340,08 $ pro Milligramm

166,00 $ pro Milligramm
Brain Natriuretic Peptide-32 rat www.molbase.com CAS-Nr.: 133448-20-1
166,00 $ pro Milligramm

0,60 $
Amyloid?|A-Peptide (1-42) (human) www.molbase.com CAS-Nr.: 107761-42-2
0,60 $
Wuhan Hezhong Biochemical Tech Co.,LTD
China
Copper peptide detail.en.china.cn
1,00 $ pro Gramm, FOB
Copper peptide detail.en.china.cn CAS-Nr.: 49557-75-7
1,00 $ pro Gramm, FOB
peptide synthesis peptide www.alibaba.com
10,00 - 50,00 $ pro Gramm, FOB
peptide synthesis peptide www.alibaba.com
10,00 - 50,00 $ pro Gramm, FOB
GL Biochem Shanghai Ltd
China
Copper Peptide www.ec21.com
50,00 $
Copper Peptide www.ec21.com CAS-Nr.: 49557-75-7
50,00 $

Peptide 810 www.guidechem.com
Preis auf Anfrage FOB
Peptide 810 www.guidechem.com CAS-Nr.: 156371-22-1
Preis auf Anfrage FOB

Fibronectin CS-1 Peptide www.guidechem.com
Preis auf Anfrage FOB
Fibronectin CS-1 Peptide www.guidechem.com CAS-Nr.: 136466-51-8
Preis auf Anfrage FOB

Preis auf Anfrage FOB
Anti-Inflammatory Peptide 1;MQMKKVLDS www.guidechem.com CAS-Nr.: 118850-71-8
Preis auf Anfrage FOB

Preis auf Anfrage FOB
(Arg)7;165893-48-1;Custom peptide www.guidechem.com CAS-Nr.: 165893-48-1
Preis auf Anfrage FOB

Preis auf Anfrage FOB
Fibrinogen-Binding Peptide;EHIPA www.guidechem.com CAS-Nr.: 137235-80-4
Preis auf Anfrage FOB

Preis auf Anfrage FOB
Glucagon-Like Peptide.(7-37);HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG www.guidechem.com CAS-Nr.: 106612-94-6
Preis auf Anfrage FOB

Preis auf Anfrage FOB
Parathyroid Hormone Related Peptide: 107-111 www.guidechem.com CAS-Nr.: 138949-73-2
Preis auf Anfrage FOB
RGDS peptide www.molbase.com
38,24 $ pro Milligramm
RGDS peptide www.molbase.com CAS-Nr.: 91037-65-9
38,24 $ pro Milligramm

HA PEPTIDE www.molbase.com
209,82 $ pro Milligramm
HA PEPTIDE www.molbase.com CAS-Nr.: 92000-76-5
209,82 $ pro Milligramm

Calpain Inhibitor Peptide www.molbase.com
1,97 $
Calpain Inhibitor Peptide www.molbase.com CAS-Nr.: 128578-18-7
1,97 $

430,56 $ pro Milligramm
Autocamtide-2-related inhibitory peptide www.molbase.com CAS-Nr.: 167114-91-2
430,56 $ pro Milligramm

175,81 $ pro Milligramm
Glucagon-Like Peptide I Amide Fragment 7-36 human www.molbase.com CAS-Nr.: 107444-51-9
175,81 $ pro Milligramm

[Ala92]-Peptide 6 www.molbase.com
0,69 $
[Ala92]-Peptide 6 www.molbase.com CAS-Nr.: 189064-08-2
0,69 $

Preis auf Anfrage
PKCBetaII Peptide Inhibitor I trifluoroacetate salt www.molbase.com CAS-Nr.: 862502-26-9
Preis auf Anfrage
RGDS peptide www.molbase.com
32,50 $ pro Milligramm
RGDS peptide www.molbase.com CAS-Nr.: 91037-65-9
32,50 $ pro Milligramm

HA PEPTIDE www.molbase.com
93,33 $ pro Milligramm
HA PEPTIDE www.molbase.com CAS-Nr.: 92000-76-5
93,33 $ pro Milligramm

466,67 $ pro Milligramm
Proinsulin connecting peptide www.molbase.com CAS-Nr.: 11097-48-6
466,67 $ pro Milligramm

476,00 $ pro Milligramm
GASTRIN RELEASING PEPTIDE, PORCINE www.molbase.com CAS-Nr.: 74815-57-9
476,00 $ pro Milligramm

0,67 $
Amyloid?|A-Peptide (1-42) (human) www.molbase.com CAS-Nr.: 107761-42-2
0,67 $
Zhejiang Ontores Biotechnologies Co., Ltd
China
Pedal peptide www.guidechem.com
8,00 $ FOB
Pedal peptide www.guidechem.com CAS-Nr.: 119758-47-3
8,00 $ FOB
Copper peptide www.diytrade.com
10,00 $ pro Gramm
Copper peptide www.diytrade.com CAS-Nr.: 49557-75-7
10,00 $ pro Gramm

Matrixyl Morphomics peptide www.alibaba.com
100,00 - 200,00 $ pro Gramm, FOB
Matrixyl Morphomics peptide www.alibaba.com CAS-Nr.: 1447824-23-8
100,00 - 200,00 $ pro Gramm, FOB

custom peptide service www.alibaba.com
50,00 - 3.000,00 $ pro Gramm, FOB
custom peptide service www.alibaba.com
50,00 - 3.000,00 $ pro Gramm, FOB

1,00 - 100,00 $ pro Gramm, FOB
1,00 - 100,00 $ pro Gramm, FOB

200,00 - 3.000,00 $ pro Gramm, FOB
Thymulin/Thymalin Bi Peptide (Synthetic Thymalin) www.alibaba.com CAS-Nr.: 63958-90-7
200,00 - 3.000,00 $ pro Gramm, FOB

1,00 - 500,00 $ pro Gramm, FOB
Cosmetic peptide Trifluoroacetyl Tripeptide-2/Progeline www.alibaba.com CAS-Nr.: 64577-63-5
1,00 - 500,00 $ pro Gramm, FOB

200,00 - 2.000,00 $ pro Gramm, FOB
Semaglutide high quality peptide API www.alibaba.com CAS-Nr.: 197922-42-2
200,00 - 2.000,00 $ pro Gramm, FOB

10,00 - 1.000,00 $ pro Milligramm, FOB
10,00 - 1.000,00 $ pro Milligramm, FOB

20,00 - 35,00 $ pro Milligramm, FOB
20,00 - 35,00 $ pro Milligramm, FOB
Copper peptide www.diytrade.com
57,00 $ pro Gramm
Copper peptide www.diytrade.com
57,00 $ pro Gramm
HA PEPTIDE www.molbase.com
86,15 $ pro Milligramm
HA PEPTIDE www.molbase.com CAS-Nr.: 92000-76-5
86,15 $ pro Milligramm

RGDS peptide www.molbase.com
30,00 $ pro Milligramm
RGDS peptide www.molbase.com CAS-Nr.: 91037-65-9
30,00 $ pro Milligramm

430,77 $ pro Milligramm
Proinsulin connecting peptide www.molbase.com CAS-Nr.: 11097-48-6
430,77 $ pro Milligramm

439,38 $ pro Milligramm
GASTRIN RELEASING PEPTIDE, PORCINE www.molbase.com CAS-Nr.: 74815-57-9
439,38 $ pro Milligramm

0,62 $
Amyloid?|A-Peptide (1-42) (human) www.molbase.com CAS-Nr.: 107761-42-2
0,62 $
peptide synthesis www.diytrade.com
50,00 $ pro Milligramm
peptide synthesis www.diytrade.com
50,00 $ pro Milligramm
Peptide
Preis auf Anfrage www.diytrade.com
Psyclo Peptide.,Inc.
China
Copper Peptide
180,00 $ www.ec21.com

Copper Peptide
180,00 $ www.ec21.com

PENTAPEPTIDE-3/VialoxPeptide
300,00 $ www.ec21.com

TETRAPEPTIDE-30
450,00 $ www.ec21.com

ACETYLTETRAPEPTIDE-5/Eyeseryl
350,00 $ www.ec21.com
RGDS peptide
CAS-Nr.: 91037-65-9
23,22 $ pro Milligramm www.molbase.com

HA PEPTIDE
CAS-Nr.: 92000-76-5
77,18 $ pro Milligramm www.molbase.com

MCD peptide
CAS-Nr.: 32908-73-9
383,00 $ pro Milligramm www.molbase.com

Proinsulin connecting peptide
CAS-Nr.: 11097-48-6
333,00 $ pro Milligramm www.molbase.com

GASTRIN RELEASING PEPTIDE, PORCINE
CAS-Nr.: 74815-57-9
340,08 $ pro Milligramm www.molbase.com

Brain Natriuretic Peptide-32 rat
CAS-Nr.: 133448-20-1
166,00 $ pro Milligramm www.molbase.com

Amyloid?|A-Peptide (1-42) (human)
CAS-Nr.: 107761-42-2
399,83 $ pro Milligramm www.molbase.com
RGDS peptide
CAS-Nr.: 91037-65-9
26,54 $ pro Milligramm www.molbase.com
collagen peptide
16,92 $ www.diytrade.com
HA PEPTIDE
CAS-Nr.: 92000-76-5
91,50 $ pro Milligramm www.molbase.com

RGDS peptide
CAS-Nr.: 91037-65-9
33,16 $ pro Milligramm www.molbase.com
HA PEPTIDE
CAS-Nr.: 92000-76-5
86,15 $ pro Milligramm www.molbase.com

RGDS peptide
CAS-Nr.: 91037-65-9
30,00 $ pro Milligramm www.molbase.com

Proinsulin connecting peptide
CAS-Nr.: 11097-48-6
430,77 $ pro Milligramm www.molbase.com

Brain Natriuretic Peptide-32 rat
CAS-Nr.: 133448-20-1
323,08 $ pro Milligramm www.molbase.com

Amyloid?|A-Peptide (1-42) (human)
CAS-Nr.: 107761-42-2
0,62 $ www.molbase.com
RGDS peptide
CAS-Nr.: 91037-65-9
31,50 $ pro Milligramm www.molbase.com

HA PEPTIDE
CAS-Nr.: 92000-76-5
51,87 $ pro Milligramm www.molbase.com

MCD peptide
CAS-Nr.: 32908-73-9
0,43 $ www.molbase.com

Proinsulin connecting peptide
CAS-Nr.: 11097-48-6
316,33 $ pro Milligramm www.molbase.com
HA PEPTIDE
CAS-Nr.: 92000-76-5
16,48 $ pro Milligramm www.molbase.com

RGDS peptide
CAS-Nr.: 91037-65-9
10,22 $ pro Milligramm www.molbase.com

SAMS Peptide
CAS-Nr.: 125911-68-4
17,00 $ pro Milligramm www.molbase.com

FLAG tag Peptide
CAS-Nr.: 98849-88-8
12,60 $ pro Milligramm www.molbase.com

MLCK inhibitor peptide
CAS-Nr.: 198694-74-5
19,20 $ pro Milligramm www.molbase.com

Dynamin inhibitory peptide
CAS-Nr.: 251634-21-6
72,00 $ pro Milligramm www.molbase.com

G-Protein antagonist peptide
CAS-Nr.: 143675-79-0
434,00 $ pro Milligramm www.molbase.com

ANTI-INFLAMMATORY PEPTIDE 1
CAS-Nr.: 118850-71-8
5,60 $ pro Milligramm www.molbase.com

Urotensin II-related peptide
CAS-Nr.: 342878-90-4
14,40 $ pro Milligramm www.molbase.com

Akt/SKG Substrate Peptide
CAS-Nr.: 276680-69-4
15,90 $ pro Milligramm www.molbase.com
HA PEPTIDE
CAS-Nr.: 92000-76-5
77,18 $ pro Milligramm www.molbase.com

RGDS peptide
CAS-Nr.: 91037-65-9
19,77 $ pro Milligramm www.molbase.com

GASTRIN RELEASING PEPTIDE, PORCINE
CAS-Nr.: 74815-57-9
340,08 $ pro Milligramm www.molbase.com

Brain Natriuretic Peptide-32 rat
CAS-Nr.: 133448-20-1
166,00 $ pro Milligramm www.molbase.com

Amyloid?|A-Peptide (1-42) (human)
CAS-Nr.: 107761-42-2
0,60 $ www.molbase.com
Wuhan Hezhong Biochemical Tech Co.,LTD
China
Copper peptide
CAS-Nr.: 49557-75-7
1,00 $ pro Gramm, FOB detail.en.china.cn
peptide synthesis peptide
10,00 - 50,00 $ pro Gramm, FOB www.alibaba.com
GL Biochem Shanghai Ltd
China
Copper Peptide
CAS-Nr.: 49557-75-7
50,00 $ www.ec21.com

Peptide 810
CAS-Nr.: 156371-22-1
Preis auf Anfrage www.guidechem.com

Fibronectin CS-1 Peptide
CAS-Nr.: 136466-51-8
Preis auf Anfrage www.guidechem.com

Anti-Inflammatory Peptide 1;MQMKKVLDS
CAS-Nr.: 118850-71-8
Preis auf Anfrage www.guidechem.com

(Arg)7;165893-48-1;Custom peptide
CAS-Nr.: 165893-48-1
Preis auf Anfrage www.guidechem.com

Atrial Natriuretic Peptide (4-24), frog;CFGSRIDRIGAQSGMGCGRRF(Disulfidebridge:1-17)
CAS-Nr.: 118691-44-4
Preis auf Anfrage www.guidechem.com

C-Type Natriuretic Peptide (32-53), human, porcine;GLSKGCFGLKLDRIGSMSGLGC(Disulfidebridge:6-22)
CAS-Nr.: 127869-51-6
Preis auf Anfrage www.guidechem.com

Fibrinogen-Binding Peptide;EHIPA
CAS-Nr.: 137235-80-4
Preis auf Anfrage www.guidechem.com

Glucagon-Like Peptide.(7-37);HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
CAS-Nr.: 106612-94-6
Preis auf Anfrage www.guidechem.com

Parathyroid Hormone Related Peptide: 107-111
CAS-Nr.: 138949-73-2
Preis auf Anfrage www.guidechem.com
RGDS peptide
CAS-Nr.: 91037-65-9
38,24 $ pro Milligramm www.molbase.com

HA PEPTIDE
CAS-Nr.: 92000-76-5
209,82 $ pro Milligramm www.molbase.com

Calpain Inhibitor Peptide
CAS-Nr.: 128578-18-7
1,97 $ www.molbase.com

Autocamtide-2-related inhibitory peptide
CAS-Nr.: 167114-91-2
430,56 $ pro Milligramm www.molbase.com

Glucagon-Like Peptide I Amide Fragment 7-36 human
CAS-Nr.: 107444-51-9
175,81 $ pro Milligramm www.molbase.com

[Ala92]-Peptide 6
CAS-Nr.: 189064-08-2
0,69 $ www.molbase.com

PKCBetaII Peptide Inhibitor I trifluoroacetate salt
CAS-Nr.: 862502-26-9
Preis auf Anfrage www.molbase.com
RGDS peptide
CAS-Nr.: 91037-65-9
32,50 $ pro Milligramm www.molbase.com

HA PEPTIDE
CAS-Nr.: 92000-76-5
93,33 $ pro Milligramm www.molbase.com

Proinsulin connecting peptide
CAS-Nr.: 11097-48-6
466,67 $ pro Milligramm www.molbase.com

GASTRIN RELEASING PEPTIDE, PORCINE
CAS-Nr.: 74815-57-9
476,00 $ pro Milligramm www.molbase.com

Amyloid?|A-Peptide (1-42) (human)
CAS-Nr.: 107761-42-2
0,67 $ www.molbase.com
Zhejiang Ontores Biotechnologies Co., Ltd
China
Pedal peptide
CAS-Nr.: 119758-47-3
8,00 $ FOB www.guidechem.com
Copper peptide
CAS-Nr.: 49557-75-7
10,00 $ pro Gramm www.diytrade.com

Matrixyl Morphomics peptide
CAS-Nr.: 1447824-23-8
100,00 - 200,00 $ pro Gramm, FOB www.alibaba.com

custom peptide service
50,00 - 3.000,00 $ pro Gramm, FOB www.alibaba.com

palmitoyl tetrapeptide-7 peptide powder
1,00 - 100,00 $ pro Gramm, FOB www.alibaba.com

custom peptide synthesis since 2008
100,00 $ FOB www.alibaba.com

Thymulin/Thymalin Bi Peptide (Synthetic Thymalin)
CAS-Nr.: 63958-90-7
200,00 - 3.000,00 $ pro Gramm, FOB www.alibaba.com

Cosmetic peptide Trifluoroacetyl Tripeptide-2/Progeline
CAS-Nr.: 64577-63-5
1,00 - 500,00 $ pro Gramm, FOB www.alibaba.com

Semaglutide high quality peptide API
CAS-Nr.: 197922-42-2
200,00 - 2.000,00 $ pro Gramm, FOB www.alibaba.com

Custom peptide Senolytics/FOXO4 DRI peptide
10,00 - 1.000,00 $ pro Milligramm, FOB www.alibaba.com

peptide synthesis FOXO4,FOXO4-DRI peptide,Senolytics
20,00 - 35,00 $ pro Milligramm, FOB www.alibaba.com
Copper peptide
57,00 $ pro Gramm www.diytrade.com
HA PEPTIDE
CAS-Nr.: 92000-76-5
86,15 $ pro Milligramm www.molbase.com

RGDS peptide
CAS-Nr.: 91037-65-9
30,00 $ pro Milligramm www.molbase.com

Proinsulin connecting peptide
CAS-Nr.: 11097-48-6
430,77 $ pro Milligramm www.molbase.com

GASTRIN RELEASING PEPTIDE, PORCINE
CAS-Nr.: 74815-57-9
439,38 $ pro Milligramm www.molbase.com

Amyloid?|A-Peptide (1-42) (human)
CAS-Nr.: 107761-42-2
0,62 $ www.molbase.com
peptide synthesis
50,00 $ pro Milligramm www.diytrade.com
10.039 Ergebnisse gefunden
Seite 1
PRO Services

Erhalten Sie Preis-Reports,
Nachfragedaten und mehr
auf einem Dashboard

Jetzt Demo buchen & exklusive Insights erhalten! Nein Danke!